PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A01323.1.p
Common NameEUGRSUZ_A01323, LOC104436960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 485aa    MW: 53070.6 Da    PI: 5.01
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A01323.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.1e-32258312155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k+r+rWtpeLHe+Fveav++LGGse+AtPk +l+lmk +gLt++hvkSHLQkYR+
  Eucgr.A01323.1.p 258 KARMRWTPELHEAFVEAVSKLGGSERATPKGVLKLMKAEGLTIYHVKSHLQKYRT 312
                       68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.922255315IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-30256314IPR009057Homeodomain-like
SuperFamilySSF466892.33E-16257312IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-24258312IPR006447Myb domain, plants
PfamPF002495.4E-10260311IPR001005SANT/Myb domain
PfamPF143792.2E-24343388IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MEASNTYSIP KPGMQQLNNV RASGAMSASS PVLPTHFEER YPKLPDSHQV TMSSSLSHGT  60
PLQSSGGAIG PMCSSTSGYS TGLHYSSVTP SEKHSGNTPF IFQSTSGSTT YIIKSSADAE  120
LLQADASTQY DNNEKASWSS DALPCIYDFP VNSPFQNNQM ENGDGIGVLA PEDFSKPNNW  180
QDWADQLINE DDESPDWAQI LSETNLPNPE SKMAHGVIKS PSSLSAHQTR LHQGLPASSG  240
DIQSANNSSS TANSSTAKAR MRWTPELHEA FVEAVSKLGG SERATPKGVL KLMKAEGLTI  300
YHVKSHLQKY RTARYRPDCS EGSSEKKLTT FEELSSLDLK TSMEITEALR MQMEVQKRLH  360
EQLEIQRKLQ LQIEEQGKYL QKMFEKQSHS GMSKLKESSS SLDDHSAPSG ELQDCPEKAE  420
YEESKEEPEK TDIDPINDSN VAPRECLQEQ GGTQSEPAAV SLESPKQGVR ESSSEPSKRQ  480
KMGV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A01323.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU1657120.0EU165712.1 Eucalyptus grandis cellulose synthase (CesA2) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010048129.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A059DF340.0A0A059DF34_EUCGR; Uncharacterized protein
STRINGVIT_07s0005g04120.t011e-163(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.11e-90phosphate starvation response 1